PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN22600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 328aa    MW: 35903.4 Da    PI: 8.8308
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN22600.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.22e-31159215158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 dep+YVNaKQy++I++RRq+Rak+  ++kl +k rkpy+heSRh hA+rRpRg+gGrF
  KHN22600.1 159 DEPIYVNAKQYHGIIRRRQSRAKAVLDHKL-TKRRKPYMHESRHLHAMRRPRGCGGRF 215
                 79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-35157218IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.606158218IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-27160215IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.6E-23161183IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.6E-23192215IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MQTVYLKEHE GNAHNFVGTL SSAASAPWWS AFGSQSVHQG ESCGQVKPFS LELPNCIDQL  60
AATKPLARGA DQVLGKGHIT QFTIFPDDCK MSDDAQKLQT TMSLQSSLTD PQSRFEIGFS  120
LPTICAKYPY TDQFYGLFSA YAPQISGRIM LPLNMTSDDE PIYVNAKQYH GIIRRRQSRA  180
KAVLDHKLTK RRKPYMHESR HLHAMRRPRG CGGRFLNTKN SVDGNGKIGN EVHKTVGEQL  240
QSSGSQSSEF LQSEVGTFNS SKETNGSSPN ISGSEVTSMY SRGGLDSFSL NHLGSAVHSF  300
ADMIDGGRGM IIPTKWVAAA GNCCNLKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-19159219262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173192RRRQSRAKAVLDHKLTKRRK
2173193RRRQSRAKAVLDHKLTKRRKP
3174193RRQSRAKAVLDHKLTKRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0925390.0BT092539.1 Soybean clone JCVI-FLGm-16A23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003521500.10.0PREDICTED: nuclear transcription factor Y subunit A-10
RefseqXP_003521501.10.0PREDICTED: nuclear transcription factor Y subunit A-10
RefseqXP_014629410.10.0PREDICTED: nuclear transcription factor Y subunit A-10
TrEMBLA0A0B2QM900.0A0A0B2QM90_GLYSO; Nuclear transcription factor Y subunit A-10
TrEMBLI1JQA10.0I1JQA1_SOYBN; Uncharacterized protein
STRINGGLYMA03G36140.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37943464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.22e-53nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]